Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vitreoscilla sp. Probable intracellular septation protein A

Recombinant Vitreoscilla sp. Probable intracellular septation protein A

SKU:CSB-CF895880VCAD

Regular price €1.470,95 EUR
Regular price Sale price €1.470,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vitreoscilla sp. (strain C1)

Uniprot NO.:Q9XD50

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNAKTLDAIKPFLDWIPLIVFFYIYKTTEGEGSEHIIAATTGLLIATLIVYGLMFVLQKF TLEKRQWLVVVLTVVFGGLTMAFQDDFYIRLKAPIINAVFAFGLAMSPLFLGGTPGIQKM LGPIFEMTPKQWMKLNWVWVGFFTLMAVLQALFAFVWVEYWAMFTAFGDMIVMVVFMVAQ FWFLRGFMRKDIK

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:

Expression Region:1-193

Sequence Info:full length protein

View full details