Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vitis vinifera CASP-like protein VIT_01s0010g01870 (VIT_01s0010g01870)

Recombinant Vitis vinifera CASP-like protein VIT_01s0010g01870 (VIT_01s0010g01870)

SKU:CSB-CF415857VFQ

Regular price €1.489,95 EUR
Regular price Sale price €1.489,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vitis vinifera (Grape)

Uniprot NO.:A7QBZ2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMGDKGEKECATASSPIELGCGEGDESGNKSSMRTVETLLRLVPVALCTVSLVVMLKNSQ TNDFGSLSYSDLGAFRYLVHANGICAGYSLLSAIFTAMPRPPTMSRAWTFFLLDQVLTYL ILAAGAVSTEVVYLAYKGDEAVTWSDACSSFGGFCQKTTASISITFVTVLCYAVLSLISS YKLFSKYDAPICFNGKGIEIAAFHS

Protein Names:Recommended name: CASP-like protein VIT_01s0010g01870

Gene Names:Ordered Locus Names:VIT_01s0010g01870 ORF Names:GSVIVT00035166001, GSVIVT01010256001, VIT_00010256001, Vv01s0010g01870

Expression Region:1-205

Sequence Info:full length protein

View full details