Recombinant Vibrio vulnificus  Fumarate reductase subunit C(frdC)

Recombinant Vibrio vulnificus Fumarate reductase subunit C(frdC)

CSB-CF748810VCQ
Regular price
€1.017,95 EUR
Sale price
€1.017,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vibrio vulnificus (strain YJ016)

Uniprot NO.:Q7MGX5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSNRKPYVREVKRTWWKDHPFYRFYMLREATVLPLILFTLFLTVGLGSLVKGPEAWQTWL NFMANPVVIAINIVALLGSLLHAHTFFSMMPQVMPIRLKGKPVDKKIIVLAQWAAVAFIS LIVLIVV

Protein Names:Recommended name: Fumarate reductase subunit C

Gene Names:Name:frdC Ordered Locus Names:VV3099

Expression Region:1-127

Sequence Info:full length protein

Your list is ready to share