GeneBio Systems
Recombinant Vibrio parahaemolyticus serotype O3:K6 Thermostable direct hemolysin 2 (tdh2)
Recombinant Vibrio parahaemolyticus serotype O3:K6 Thermostable direct hemolysin 2 (tdh2)
SKU:P19250
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P19250
Gene Names: tdh2
Alternative Name(s): Kanagawa phenomenon-associated hemolysin
Abbreviation: Recombinant Vibrio parahaemolyticus serotype O3: K6 tdh2 protein
Organism: Vibrio parahaemolyticus serotype O3: K6 (strain RIMD 2210633)
Source: E.coli
Expression Region: 25-189aa
Protein Length: Full Length of Mature Protein
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: FELPSVPFPAPGSDEILFVVRDTTFNTNAPVNVEVSDFWTNRNVKRKPYKDVYGQSVFTTSGTKWLTSYMTVNINDKDYTMAAVSGYKHGHSAVFVKSDQVQLQHSYDSVANFVGEDEDSIPSKMYLDETPEYFVNVEAYESGSGNILVMCISNKESFFECKHQQ
MW: 25.6 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Bacterial hemolysins are exotoxins that attack blood cell membranes and cause cell rupture by mechanisms not clearly defined.
Reference:
Function:
