Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vibrio harveyi Probable intracellular septation protein A (VIBHAR_02768)

Recombinant Vibrio harveyi Probable intracellular septation protein A (VIBHAR_02768)

SKU:CSB-CF417158VEA

Regular price €1.474,95 EUR
Regular price Sale price €1.474,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vibrio harveyi (strain ATCC BAA-1116 / BB120)

Uniprot NO.:A7MRY6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQILDFIPLIVFFALYKMYDIYVATGALIVATAIQIVLTFALYKKVEKMQLITFAMVAI FGGMTIFLHDENFIKWKVTIVYAIFAIGLAVSHAMGKSAIKGMLGKEITLPDAIWTKINW AWVAFFSFCAGLNVYVAFELPLDVWVNFKVFGLLIATFAYMIATGFYIYKHMPKEQKEQK EKSSDVSLDD

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:VIBHAR_02768

Expression Region:1-190

Sequence Info:full length protein

View full details