Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vibrio harveyi Na(+)-translocating NADH-quinone reductase subunit C(nqrC)

Recombinant Vibrio harveyi Na(+)-translocating NADH-quinone reductase subunit C(nqrC)

SKU:CSB-CF886476VEA

Regular price €1.534,95 EUR
Regular price Sale price €1.534,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vibrio harveyi (strain ATCC BAA-1116 / BB120)

Uniprot NO.:Q9RFV9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ASNNDSIKKTLGVVVGLSLVCSIIVSTAAVGLRDQQKANAVLDKQSKIVEVAGIDAEGKK VPELFAEYIEPRLVDFKTGDFVEKAEDGSTAANYDQRKAAKDPAESIKLTADEDKAKILR RANTGIVYLVKNGDDISKVIIPVHGNGLWSMMYAFVAVETDGNTVSGITYYEQGETPGLG GEVENPVWRAQFVGKKLFDENHKPAIKIVKGGAPEGSEHGVDGLSGATLTGNGVQGTFDF WLGDMGFGPFLAKVRDGGLN

Protein Names:Recommended name: Na(+)-translocating NADH-quinone reductase subunit C Short name= Na(+)-NQR subunit C Short name= Na(+)-translocating NQR subunit C EC= 1.6.5.- Alternative name(s): NQR complex subunit C NQR-1 subunit C

Gene Names:Name:nqrC Ordered Locus Names:VIBHAR_03273

Expression Region:2-261

Sequence Info:full length protein

View full details