Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vibrio cholerae serotype O1 Universal stress protein B homolog(uspB)

Recombinant Vibrio cholerae serotype O1 Universal stress protein B homolog(uspB)

SKU:CSB-CF398381VEY

Regular price €1.379,95 EUR
Regular price Sale price €1.379,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395)

Uniprot NO.:A5F4E9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISGDTILFALMLVTAINVARYVTALRSLIYIMREAHPLLYQQVDGRGFFTTHGNVTKQV RLYHYLKSREYHHHHDPVFTGKCDRVRELFILSGSLLVLTTVVAFML

Protein Names:Recommended name: Universal stress protein B homolog

Gene Names:Name:uspB Ordered Locus Names:VC0395_A2436, VC395_0101

Expression Region:1-107

Sequence Info:full length protein

View full details