Skip to product information
1 of 1

Gene Bio Systems

Recombinant Varicella-zoster virus Protein UL20 homolog(39)

Recombinant Varicella-zoster virus Protein UL20 homolog(39)

SKU:CSB-CF362645VAP

Regular price €1.511,95 EUR
Regular price Sale price €1.511,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Varicella-zoster virus (strain Dumas) (HHV-3) (Human herpesvirus 3)

Uniprot NO.:P09290

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNPPQARVSEQTKDLLSVMVNQHPEEDAKVCKSSDNSPLYNTMVMLSYGGDTDLLLSSAC TRTSTVNRSAFTQHSVFYIISTVLIQPICCIFFFFYYKATRCMLLFTAGLLLTILHHFRL IIMLLCVYRNIRSDLLPLSTSQQLLLGIIVVTRTMLFCITAYYTLFIDTRVFFLITGHLQ SEVIFPDSVSKILPVSWGPSPAVLLVMAAVIYAMDCLVDTVSFIGPRVWVRVMLKTSISF

Protein Names:Recommended name: Protein UL20 homolog Alternative name(s): Gene 39 membrane protein

Gene Names:Name:39

Expression Region:1-240

Sequence Info:full length protein

View full details