Gene Bio Systems
Recombinant Vanderwaltozyma polyspora NADH-cytochrome b5 reductase 1(CBR1)
Recombinant Vanderwaltozyma polyspora NADH-cytochrome b5 reductase 1(CBR1)
SKU:CSB-CF006318VDW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)
Uniprot NO.:A7TNL7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAESMNKIFIAIIAIAVAAAATKMFTSEEPKSKALPVLVKGEYMQFPLVSIKKLNRNSAIYRFKLPTDEHVLGLPIGQHITIKAHIDGSEVVRSYTPISLDSEAKGYFELLIKSYEQGKISKMFTSLKIGDTIDVQGPKGFYEYTDRSSKHLAMIAGGSGLTPMYQIIKSIAENPKDKTKVTFIYGNVEEIDILLRDDLDKFAASKPGQITIHYLLDKPSENWKGGSGYVTPELMKEKLPAPADGVQLLVCGPLPMVSAIKRSAVALGFPKAKPVSKMNDQVFVF
Protein Names:Recommended name: NADH-cytochrome b5 reductase 1 EC= 1.6.2.2 Alternative name(s): Microsomal cytochrome b reductase
Gene Names:Name:CBR1 ORF Names:Kpol_1070p17
Expression Region:1-285
Sequence Info:full length protein
