Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vaccinia virus Protein L2(MVA081R, ACAM3000_MVA_081)

Recombinant Vaccinia virus Protein L2(MVA081R, ACAM3000_MVA_081)

SKU:CSB-CF741744VEE

Regular price €1.372,95 EUR
Regular price Sale price €1.372,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vaccinia virus (strain Ankara) (VACV)

Uniprot NO.:Q76RD1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEVIADRLDDIVKQNIADEKFVDFVIHGLEHQCPAILRPLIRLFIDILLFVIVIYIFTVR LVSRNYQMLLALVALVITLTIFYYFIL

Protein Names:Recommended name: Protein L2

Gene Names:Ordered Locus Names:MVA081R, ACAM3000_MVA_081

Expression Region:1-87

Sequence Info:full length protein

View full details