Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vaccinia virus Plaque-size-host range protein(PS-HR),partial

Recombinant Vaccinia virus Plaque-size-host range protein(PS-HR),partial

SKU:CSB-CF328444VAG

Regular price €702,95 EUR
Regular price Sale price €702,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Others

Uniprot ID: P24083

Gene Names: PS/HR

Organism: Vaccinia virus (strain Lister) (VACV)

AA Sequence: VYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEKFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH

Expression Region: 18-279aa

Sequence Info: Extracellular Domain

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-tagged

MW: 33.2 kDa

Alternative Name(s): Protein B5

Relevance: Regulation of plaque size and host range.

Reference: "Regulation of plaque size and host range by a vaccinia virus gene related to complement system proteins."Takahashi-Nishimaki F., Funahashi S., Miki K., Hashizume S., Sugimoto M.Virology 181:158-164(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details