Gene Bio Systems
Recombinant V-type proton ATPase subunit e(vha-17)
Recombinant V-type proton ATPase subunit e(vha-17)
SKU:CSB-CF631328CXY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caenorhabditis elegans
Uniprot NO.:Q20591
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGILIPLVSVSAFWAIIGFGGPWIVPKGPNRGIIQLMIIMTAVCCWMFWIMVFLHQLNPL IGPQINVKTIRWISEKWGDAPNVINN
Protein Names:Recommended name: V-type proton ATPase subunit e Short name= V-ATPase subunit e Alternative name(s): Vacuolar proton pump subunit e
Gene Names:Name:vha-17 ORF Names:F49C12.13
Expression Region:1-86
Sequence Info:full length protein
