Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0756 membrane protein BA_4840-GBAA_4840-BAS4489(BA_4840, GBAA_4840, BAS4489)

Recombinant UPF0756 membrane protein BA_4840-GBAA_4840-BAS4489(BA_4840, GBAA_4840, BAS4489)

SKU:CSB-CF769045BQE

Regular price €1.435,95 EUR
Regular price Sale price €1.435,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus anthracis

Uniprot NO.:Q81KZ4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFLGDKVFPYLQTKGINLGVTVIT IAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTDPHITTALVFG TIIAVALFNGVAVGPLIGAGIAYAVMSIIQMFK

Protein Names:Recommended name: UPF0756 membrane protein BA_4840/GBAA_4840/BAS4489

Gene Names:Ordered Locus Names:BA_4840, GBAA_4840, BAS4489

Expression Region:1-153

Sequence Info:full length protein

View full details