Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0442 protein YPO0485-y3689-YP_3694(YPO0485, y3689, YP_3694)

Recombinant UPF0442 protein YPO0485-y3689-YP_3694(YPO0485, y3689, YP_3694)

SKU:CSB-CF748315YAS

Regular price €1.439,95 EUR
Regular price Sale price €1.439,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yersinia pestis

Uniprot NO.:Q74Q23

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGVSLLWALLQDMVLAAIPALGFAMVFNVPVRALRYCALLGAIGHGSRMLMIHFGMNIEL ASLVASIMIGINWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEALMST MVTNFLKASFIVGALSIGLSLPGLWLYRKRPGV

Protein Names:Recommended name: UPF0442 protein YPO0485/y3689/YP_3694

Gene Names:Ordered Locus Names:YPO0485, y3689, YP_3694

Expression Region:1-153

Sequence Info:full length protein

View full details