Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0394 membrane protein XF_0765(XF_0765)

Recombinant UPF0394 membrane protein XF_0765(XF_0765)

SKU:CSB-CF879208XBL

Regular price €1.428,95 EUR
Regular price Sale price €1.428,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xylella fastidiosa

Uniprot NO.:Q9PFB3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLHVTLRFTVALAAGLLFGFGLALSEMINPIRVLSFLNVASGHWNPSLLFVLGSALAVA FPGMALQRRLKRPLLDECFHLPSKKVIDRRIVFGSAIFGTGWGLTGLCPGPAIASLSTGL GPVLLFVAAMAAGMIIHDRIVVRCLS

Protein Names:Recommended name: UPF0394 membrane protein XF_0765

Gene Names:Ordered Locus Names:XF_0765

Expression Region:1-146

Sequence Info:full length protein

View full details