Gene Bio Systems
Recombinant UPF0299 membrane protein YPO1514-y2654-YP_1404(YPO1514, y2654, YP_1404)
Recombinant UPF0299 membrane protein YPO1514-y2654-YP_1404(YPO1514, y2654, YP_1404)
SKU:CSB-CF810739YAS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pestis
Uniprot NO.:Q8D074
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRNMMSLCWQYLRAFTIIYLCLWAGKALALLLPIVIPGSIIGMLILFVLLTLQILPSPWV KPSCQLLIRYMALLFVPIGVGVMQYYEQLTKQFGPIVVSCFISTLIVMLVVAYSSHYVHR DRKVISPSTPTEGEK
Protein Names:Recommended name: UPF0299 membrane protein YPO1514/y2654/YP_1404
Gene Names:Ordered Locus Names:YPO1514, y2654, YP_1404
Expression Region:1-135
Sequence Info:full length protein
