Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0154 protein spyM18_0409 (spyM18_0409)

Recombinant UPF0154 protein spyM18_0409 (spyM18_0409)

SKU:CSB-CF300643SMU

Regular price €1.358,95 EUR
Regular price Sale price €1.358,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptococcus pyogenes serotype M18

Uniprot NO.:P67297

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTAIWILLLIVALGVGVFGGIFIARKQIEKEIGEHPRLTPEAIREMMSQMGQKPSEAKIQQTYRNIIKQSKAAVSKGKK

Protein Names:Recommended name: UPF0154 protein spyM18_0409

Gene Names:Ordered Locus Names:spyM18_0409

Expression Region:1-80

Sequence Info:full length protein

View full details