Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0126 inner membrane protein yicG(yicG)

Recombinant UPF0126 inner membrane protein yicG(yicG)

SKU:CSB-CF314731SZB

Regular price €1.484,95 EUR
Regular price Sale price €1.484,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Shigella flexneri

Uniprot NO.:P0AGM4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLLHILYLVGITAEAMTGALAAGRRRMDTFGVIIIATATAIGGGSVRDILLGHYPLGWVK HPEYVIIVATAAVLTTIVAPVMPYLRKVFLVLDALGLVVFSIIGAQVALDMGHGPIIAVV AAVTTGVFGGVLRDMFCKRIPLVFQKELYAGVSFASAVLYIALQHYVSNHDVVIISTLVF GFFARLLALRLKLGLPVFYYSHEGH

Protein Names:Recommended name: UPF0126 inner membrane protein yicG

Gene Names:Name:yicG Ordered Locus Names:SF3685, S4083

Expression Region:1-205

Sequence Info:full length protein

View full details