Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0059 membrane protein BA_5567-GBAA_5567-BAS5173(BA_5567, GBAA_5567, BAS5173)

Recombinant UPF0059 membrane protein BA_5567-GBAA_5567-BAS5173(BA_5567, GBAA_5567, BAS5173)

SKU:CSB-CF774065BQE

Regular price €1.458,95 EUR
Regular price Sale price €1.458,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus anthracis

Uniprot NO.:Q81JX6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTFEQLIPLIIMAFALGMDAFSVSLGMGMMALKIRQILYIGVTIGIFHIIMPFIGMVLGR FLSEQYGDIAHFAGAILLIGLGFYIVYSSILENEETRTAPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTIITILLFGFVSMLLAWIGLLIGRHAKGMLGTYGEIVGGIILVGFGLYLLF PI

Protein Names:Recommended name: UPF0059 membrane protein BA_5567/GBAA_5567/BAS5173

Gene Names:Ordered Locus Names:BA_5567, GBAA_5567, BAS5173

Expression Region:1-182

Sequence Info:full length protein

View full details