Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0057 membrane protein ZK632.10 (ZK632.10)

Recombinant UPF0057 membrane protein ZK632.10 (ZK632.10)

SKU:CSB-CF327352CXY

Regular price €1.362,95 EUR
Regular price Sale price €1.362,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:P34655

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MCQILLAILAIFLPPIAVLLDVGCNCDLLINILLTCLGIIPGIIHAWYIILCKEKTVVQN IYVQTNDHGTAPPAYSPYSA

Protein Names:Recommended name: UPF0057 membrane protein ZK632.10

Gene Names:ORF Names:ZK632.10

Expression Region:1-80

Sequence Info:full length protein

View full details