Gene Bio Systems
Recombinant Uncharacterized protein YPO1740-y2567-YP_1481(YPO1740, y2567, YP_1481)
Recombinant Uncharacterized protein YPO1740-y2567-YP_1481(YPO1740, y2567, YP_1481)
SKU:CSB-CF849373YAS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pestis
Uniprot NO.:Q8ZFG9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLDTNMSAFGVASIALPLLTVLFFLIVWFFLSRASVRANEQVRLLREIAEQQKRQTELLT ALLENATGTRDGQNDSDTVSPLDFKGFIPER
Protein Names:Recommended name: Uncharacterized protein YPO1740/y2567/YP_1481
Gene Names:Ordered Locus Names:YPO1740, y2567, YP_1481
Expression Region:1-91
Sequence Info:full length protein
