Recombinant  Uncharacterized protein yjeT(yjeT)

Recombinant Uncharacterized protein yjeT(yjeT)

CSB-CF360231SZB
Regular price
€974,95 EUR
Sale price
€974,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Shigella flexneri

Uniprot NO.:P0AF75

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNSTIWLALALVLVLEGLGPMLYPKAWKKMISAMTNLPDNILRRFGGGLVVAGVVVYYML RKTIG

Protein Names:Recommended name: Uncharacterized protein yjeT

Gene Names:Name:yjeT Ordered Locus Names:SF4331, S4599

Expression Region:1-65

Sequence Info:full length protein

Your list is ready to share