Gene Bio Systems
Recombinant Uncharacterized protein ygaM(ygaM)
Recombinant Uncharacterized protein ygaM(ygaM)
SKU:CSB-CF365018EOD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli O157:H7
Uniprot NO.:P0ADQ9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGDHMFNRPNRNDVDDGVQDIQNDVNQLADSLESVLKSWGSDAKGEAEAARSKAQALLKE TRARMHGRTRVQQAARDAVGCADSFVRERPWCSVGTAAAVGIFIGALLSMRKS
Protein Names:Recommended name: Uncharacterized protein ygaM
Gene Names:Name:ygaM Ordered Locus Names:Z3972, ECs3533
Expression Region:1-113
Sequence Info:full length protein
