Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein Rv2206-MT2262 (Rv2206, MT2262)

Recombinant Uncharacterized protein Rv2206-MT2262 (Rv2206, MT2262)

SKU:CSB-CF354429MVZ

Regular price €1.520,95 EUR
Regular price Sale price €1.520,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P64951

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLLGHRKSHGHQRADASPDAGSKDGCRPDSGRTSGSDTSRGSQTTGPKGRPTPKRNQSR RHTKKGPVAPAPMTAAQARARRKSLAGPKLSREERRAEKAANRARMTERRERMMAGEEAY LLPRDRGPVRRYVRDVVDSRRNLLGLFMPSALTLLFVMFAVPQVQFYLSPAMLILLALMT IDAIILGRKVGRLVDTKFPSNTESRWRLGLYAAGRASQIRRLRAPRPQVERGGDVG

Protein Names:Recommended name: Uncharacterized protein Rv2206/MT2262

Gene Names:Ordered Locus Names:Rv2206, MT2262 ORF Names:MTCY190.17

Expression Region:1-236

Sequence Info:full length protein

View full details