Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein Rv1342c-MT1383 (Rv1342c, MT1383)

Recombinant Uncharacterized protein Rv1342c-MT1383 (Rv1342c, MT1383)

SKU:CSB-CF358666MVZ

Regular price €1.402,95 EUR
Regular price Sale price €1.402,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P0A5E7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTAPETPAAQHAEPAIAVERIRTALLGYRIMAWTTGLWLIALCYEIVVRYVVKVDNPPTW IGVVHGWVYFTYLLLTLNLAVKVRWPLGKTAGVLLAGTIPLLGIVVEHFQTKEIKARFGL

Protein Names:Recommended name: Uncharacterized protein Rv1342c/MT1383

Gene Names:Ordered Locus Names:Rv1342c, MT1383 ORF Names:MTCY02B10.06c

Expression Region:1-120

Sequence Info:full length protein

View full details