Gene Bio Systems
Recombinant Uncharacterized protein ML1584(ML1584)
Recombinant Uncharacterized protein ML1584(ML1584)
SKU:CSB-CF871719MVN
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium leprae
Uniprot NO.:Q9CBU2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MASTEGEHNAGVDPAEVPSVAWGWSRINHHTWHIVGLFAIGLLLAMLRGNHIGHVENWYL IGFAALVFFVLIRDLLGRRRGWIR
Protein Names:Recommended name: Uncharacterized protein ML1584
Gene Names:Ordered Locus Names:ML1584
Expression Region:1-84
Sequence Info:full length protein
