Gene Bio Systems
Recombinant Uncharacterized protein Mb1377c (Mb1377c)
Recombinant Uncharacterized protein Mb1377c (Mb1377c)
SKU:CSB-CF363694MVH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium bovis
Uniprot NO.:P0A5E8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTAPETPAAQHAEPAIAVERIRTALLGYRIMAWTTGLWLIALCYEIVVRYVVKVDNPPTW IGVVHGWVYFTYLLLTLNLAVKVRWPLGKTAGVLLAGTIPLLGIVVEHFQTKEIKARFGL
Protein Names:Recommended name: Uncharacterized protein Mb1377c
Gene Names:Ordered Locus Names:Mb1377c
Expression Region:1-120
Sequence Info:full length protein