Gene Bio Systems
Recombinant Uncharacterized membrane protein yhzF(yhzF)
Recombinant Uncharacterized membrane protein yhzF(yhzF)
SKU:CSB-CF498727BRI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis
Uniprot NO.:C0H3Y3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSVFLIVLSCITLAFASGAVYYIKLLSQAASYPPKRVIRQKALVCSTGTAFTLCLIFFTK LLA
Protein Names:Recommended name: Uncharacterized membrane protein yhzF
Gene Names:Name:yhzF Ordered Locus Names:BSU10009
Expression Region:1-63
Sequence Info:full length protein
