Skip to product information
1 of 1

Gene Bio Systems

Recombinant Triticum aestivum Trypsin-alpha-amylase inhibitor CMx1-CMx3

Recombinant Triticum aestivum Trypsin-alpha-amylase inhibitor CMx1-CMx3

SKU:CSB-EP675990TQN

Regular price €775,95 EUR
Regular price Sale price €775,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: N/A

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Triticum aestivum (Wheat)

Delivery time: 3-7 business days

Uniprot ID: Q43723

AA Sequence: FREQCVPGREITYESLNARREYAVRQTCGYYLSAERQKRRCCDELSKVPELCWCEVLRILMDRRVTKEGVVKGSLLQDMSRCKKLTREFIAGIVGRE

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 25-121aa

Protein length: Full Length of Mature Protein

MW: 31.4 kDa

Alternative Name(s): ITRL-1/ITRL-3

Relevance:

Reference: "Sharp divergence between wheat and barley at loci encoding novel members of the trypsin/alpha-amylase inhibitors family." Sanchez de la Hoz P., Castagnaro A., Carbonero P. Plant Mol. Biol. 26:1231-1236(1994)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details