Gene Bio Systems
Recombinant Trichosanthes kirilowii Ribosome-inactivating protein karasurin-C
Recombinant Trichosanthes kirilowii Ribosome-inactivating protein karasurin-C
SKU:CSB-YP326146TIF
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P24478
Gene Names: N/A
Organism: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)
AA Sequence: EGDVSFRLSGATSSSYGVFISNLRKALPYERKLYDIPLLRSTLPGSQRYALIHLTNYADETISVAIDVTNVYVMGYRAGDTSYFFNEASATEAAKYVFKDAKRKVTLPYSGNYERLQIAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFETPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
Expression Region: 22-270aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 29.4 kDa
Alternative Name(s): rRNA N-glycosidase Cleaved into the following chain: Ribosome-inactivating protein karasurin-A
Relevance: Abortion-inducing protein. It inactivates eukaryotic 60S ribosomal subunits.
Reference: "Amino acid sequences and ribosome-inactivating activities of karasurin-B and karasurin-C."Kondo T., Mizukami H., Takeda T., Ogihara Y. Biol. Pharm. Bull. 19:1485-1489(1996)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
