Gene Bio Systems
Recombinant Treponema pallidum Uncharacterized protein TP_0708 (TP_0708)
Recombinant Treponema pallidum Uncharacterized protein TP_0708 (TP_0708)
SKU:CSB-CF528182TPR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Treponema pallidum (strain Nichols)
Uniprot NO.:O83706
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDVQERRFSCAAVGASLKVPAIAAGAAFFLSIATAAVARNARVYVSVARATVLALGAGVT AYALRALLAYVVPDLLVQEDGKMPIPHVDLTLDDVVEPSFASPGGDVVQETDDSFDSLIP TGELGELGYSFSPSTPSFEDKTSDLVGDVLTDLPETKRMARAIRTVLSQDT
Protein Names:Recommended name: Uncharacterized protein TP_0708
Gene Names:Ordered Locus Names:TP_0708
Expression Region:1-171
Sequence Info:full length protein
