Skip to product information
1 of 1

Gene Bio Systems

Recombinant Thermoanaerobacter tengcongensis Membrane protein insertase YidC(yidC)

Recombinant Thermoanaerobacter tengcongensis Membrane protein insertase YidC(yidC)

SKU:CSB-CF851295TCX

Regular price €1.489,95 EUR
Regular price Sale price €1.489,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Thermoanaerobacter tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Caldanaerobacter subterraneus subsp. tengcongensis)

Uniprot NO.:Q8R6K6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MATIAMYLGQLLEFIHHYVGNYGVAIIVFTVFIRILLLPFYIQQMAMMKKMKEIQPLVEE LKKKYGKDPQKLNMETMKLYQEKKINPFGGCLPMLLPLIILWPLFTMLRTYPAFSTASFL WMHSLAERDPYYIIPILATVTTYISSAMVATDKSQNSMNIMMSLFMGWITVTLPAGVGIY WVTSNIFQIVQQYIFMRETKTLKGES

Protein Names:Recommended name: Membrane protein insertase YidC Alternative name(s): Foldase YidC Membrane integrase YidC Membrane protein YidC

Gene Names:Name:yidC Ordered Locus Names:TTE2799

Expression Region:1-206

Sequence Info:full length protein

View full details