Gene Bio Systems
Recombinant Syntrophomonas wolfei subsp. wolfei Large-conductance mechanosensitive channel(mscL)
Recombinant Syntrophomonas wolfei subsp. wolfei Large-conductance mechanosensitive channel(mscL)
SKU:CSB-CF601859SAAM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Syntrophomonas wolfei subsp. wolfei (strain Goettingen)
Uniprot NO.:Q0AWD5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MWKEFREFAMRGNVIDLAIGIIIGAAFGKIVTSFVNDILMPPIGLLLGKVDFTNLYINLS GKNYSSLADATAAGAPVIKYGVFLNSIIDFIIVAVAIFLVVKQINRLKKQEVAAAPTTKE CRYCKSEISIAATRCPFCTSELLDTGRPLK
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:Swol_1671
Expression Region:1-150
Sequence Info:full length protein
