
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Synechocystis sp. (strain PCC 6803 / Kazusa)
Uniprot NO.:P74155
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDFGIGFISTNIMLPILDFFFGIVHSYGFAIIALTLVIRLGLYPLSAGQIRNMRKMRITQ PLMKERQEEIQKRYKDDPAKQQEEMAKVMKEFGNPLAGCLPLLLQMPILFALFATLRGSP FSDINYTVDLQILPQEQVERIVPQTFSTKPQNIYVDEALHYPIAVFLPGGKMLGVGEKTQ LEIQSTEGKAFNQVIPEKNSQILTPTYSVTKGEDRISVNPDGTIEALVPGDATVQVTIPG IAARTGFLFIKALGQVGVTGENGEINWDILGMIVFFGFSIYLNQELSGASGGGAPNAQAQ QQQTINKITPILFSGMFLFFPLPAGVLMYIVMANVFQTIQTLILMREPLPENLQKLLDEQ QKATQGRESLPFEKKSSKKKEKTS
Protein Names:Recommended name: Membrane protein insertase YidC Alternative name(s): Alb3 Foldase YidC Membrane integrase YidC Membrane protein YidC Oxa1 SynYidC
Gene Names:Name:yidC Synonyms:alb3 Ordered Locus Names:slr1471
Expression Region:1-384
Sequence Info:full length protein
You may also like
-
Recombinant Synechococcus sp. Membrane protein insertase YidC(yidC)
- Regular price
- €1.500,95 EUR
- Sale price
- €1.500,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Membrane protein insertase YidC(yidC)
- Regular price
- €1.544,95 EUR
- Sale price
- €1.544,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Nostoc sp. Membrane protein insertase YidC(yidC)
- Regular price
- €1.500,95 EUR
- Sale price
- €1.500,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Membrane protein insertase YidC(yidC)
- Regular price
- €1.516,95 EUR
- Sale price
- €1.516,95 EUR
- Regular price
-
- Unit price
- per
Sold out