Recombinant Synechococcus sp.  NAD(P)H-quinone oxidoreductase subunit 3

Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit 3

CSB-CF401184SVC
Regular price
€1.020,95 EUR
Sale price
€1.020,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Synechococcus sp. (strain WH7803)

Uniprot NO.:A5GIB3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFVLPGYDAFLGFLLIAAAVPVLALVTNKLLAPRSQDGERQLTYESGMEPIGGAWIQFNI RYYMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVVALAYAWRKGALEWS

Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 3 EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 3 NADH-plastoquinone oxidoreductase subunit 3 NDH-1 subunit 3 Short name= NDH-C

Gene Names:Name:ndhC Ordered Locus Names:SynWH7803_0252

Expression Region:1-120

Sequence Info:full length protein

Your list is ready to share