Skip to product information
1 of 1

Gene Bio Systems

Recombinant Synechococcus elongatus Thiol:disulfide interchange protein txlA(txlA)

Recombinant Synechococcus elongatus Thiol:disulfide interchange protein txlA(txlA)

SKU:CSB-CF327387FPY

Regular price €1.474,95 EUR
Regular price Sale price €1.474,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)

Uniprot NO.:P35088

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTADNSVPSRLRNILVIAAALVLTILVVLGSRQPSAAASLASLAEQATPYEVAIANDRPM LLEFYADWCTSCQAMAGRIAALKQDYSDRLDFVMLNIDNDKWLPEVLDYNVDGIPQFVYL NGQGQPQGISIGELPRSVLAANLDALVEAQPLPYTNARGNLSEFSADLQPSRSSQTDPRS HSGQVQDGVLD

Protein Names:Recommended name: Thiol:disulfide interchange protein txlA

Gene Names:Name:txlA Ordered Locus Names:Synpcc7942_2128

Expression Region:1-191

Sequence Info:full length protein

View full details