Gene Bio Systems
Recombinant Sulfolobus solfataricus UPF0290 protein SSO0776(SSO0776)
Recombinant Sulfolobus solfataricus UPF0290 protein SSO0776(SSO0776)
SKU:CSB-CF892608FPM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Uniprot NO.:Q9UXG3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSIAYDLLLSILIYLPAFVANGSGPFIKRGTPIDFGKNFVDGRRLFGDGKTFEGLIVALT FGTTVGVIISKFFTAEWTLISFLESLFAMIGDMIGAFIKRRLGIPRGGRVLGLDQLDFVL GASLILVLMRVNITWYQFLFICGLAFFLHQGTNYVAYLLKIKNVPW
Protein Names:Recommended name: UPF0290 protein SSO0776
Gene Names:Ordered Locus Names:SSO0776 ORF Names:C40_012
Expression Region:1-166
Sequence Info:full length protein
