Gene Bio Systems
Recombinant Sulfolobus islandicus rod-shaped virus 1 Uncharacterized protein 98(98)
Recombinant Sulfolobus islandicus rod-shaped virus 1 Uncharacterized protein 98(98)
SKU:CSB-CF851223FPH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sulfolobus islandicus rod-shaped virus 1 (SIRV-1) (Sulfolobus virus SIRV-1)
Uniprot NO.:Q8QL14
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAITLLEGALYGFFAVTGVLIASFIIGEIVHLYNEKQSNENFAKAIDQMSKSTVTAIESI KDTTVTGINALLNMDTLRDVNSLAREKAKDQNPSSQAK
Protein Names:Recommended name: Uncharacterized protein 98
Gene Names:ORF Names:98
Expression Region:1-98
Sequence Info:full length protein
