
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Subterranean clover stunt virus (strain F) (SCSV)
Uniprot NO.:Q87008
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDSGDGYNTYSYEEGAGDAKKEVLYKIGIIMLCIVGIVVLWVLIILCCAVPRYAKSTMDA WLSSSSIMKRKMASRITGTPFEETGPHRERRWAERRTEATNQNNNDNVNRFS
Protein Names:Recommended name: Putative movement protein Short name= MP
Gene Names:Name:DNA-M Synonyms:C1
Expression Region:1-112
Sequence Info:full length protein
You may also like
-
Recombinant Faba bean necrotic yellows virus Putative movement protein(DNA-M)
- Regular price
- €1.021,95 EUR
- Sale price
- €1.021,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Faba bean necrotic yellows virus Putative movement protein(DNA-M)
- Regular price
- €1.021,95 EUR
- Sale price
- €1.021,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Maize streak virus genotype C Movement protein (V2)
- Regular price
- €1.012,95 EUR
- Sale price
- €1.012,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant White clover mosaic virus Movement protein TGB2 (ORF3)
- Regular price
- €1.022,95 EUR
- Sale price
- €1.022,95 EUR
- Regular price
-
- Unit price
- per
Sold out