Gene Bio Systems
Recombinant Streptomyces coelicolor UPF0233 membrane protein SCO3854(SCO3854)
Recombinant Streptomyces coelicolor UPF0233 membrane protein SCO3854(SCO3854)
SKU:CSB-CF894945FOB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Uniprot NO.:Q9XA10
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPKSRIRKKADYTPPPSKQATSIKLTSRGWVAPVMLAMFVIGLAWIVVFYVTDGSLPIDS LGNWNIVVGFGFIAAGFGVSTQWK
Protein Names:Recommended name: UPF0233 membrane protein SCO3854
Gene Names:Ordered Locus Names:SCO3854 ORF Names:SCH69.24
Expression Region:1-84
Sequence Info:full length protein
