Gene Bio Systems
Recombinant Staphylococcus haemolyticus Glycosyl-4,4'-diaponeurosporenoate acyltransferase(crtO)
Recombinant Staphylococcus haemolyticus Glycosyl-4,4'-diaponeurosporenoate acyltransferase(crtO)
SKU:CSB-CF680629SBAH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus haemolyticus (strain JCSC1435)
Uniprot NO.:Q4L979
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:NMMLRCPTSVFVKYETFFKIWSWEKRGALWNKLFRINKWKHYIPEAAQFNYRIYNKRRLA SFKLEDIHFMILEMRRAELVHWLSMIPIVIFIKAPKYILFINVCYVISAKLPIILTQRYN RPRLEHYYQLRMKRDERTCRKRKSSL
Protein Names:Recommended name: Glycosyl-4,4'-diaponeurosporenoate acyltransferase EC= 2.3.1.-
Gene Names:Name:crtO Ordered Locus Names:SH0487
Expression Region:26-171
Sequence Info:full length protein
