Gene Bio Systems
Recombinant Staphylococcus epidermidis UPF0344 protein SE_0666(SE_0666)
Recombinant Staphylococcus epidermidis UPF0344 protein SE_0666(SE_0666)
SKU:CSB-CF815974SLD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus epidermidis (strain ATCC 12228)
Uniprot NO.:Q8CT77
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLHVHILSWVLAIILFIATYLNYSKTQGASPYYKPLHMALRLFMLLTLISGFWELIEEFM AASNGEGGNHMLLTLKMLCGLAVIAFMEISIAKRKKQQTSHKFFWITIILIIITMAIGVI LPWGPISKIFGIS
Protein Names:Recommended name: UPF0344 protein SE_0666
Gene Names:Ordered Locus Names:SE_0666
Expression Region:1-133
Sequence Info:full length protein
