Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 3(qoxC)

Recombinant Staphylococcus epidermidis Probable quinol oxidase subunit 3(qoxC)

SKU:CSB-CF807580SLD

Regular price €1.483,95 EUR
Regular price Sale price €1.483,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Staphylococcus epidermidis (strain ATCC 12228)

Uniprot NO.:Q8CPP8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSHDANTIDSRTHEGELNKLGFWIFLTAEFALFGTLFATLLTLQHGGGYGGKLTTDLFEL HLILIMTFALLISSYTCGIAIYYMRQEKQNLMMFWMIITVILGLVFVGFEIYEFAHYASE GVNPTIGSFWSSFFILLGTHGAHVSLGIVWVICLLIQIGTRGLDSYNAPKLFIVSLYWHF LDVVWVFIFTAVYMIGMVYSG

Protein Names:Recommended name: Probable quinol oxidase subunit 3 EC= 1.10.3.- Alternative name(s): Quinol oxidase polypeptide III

Gene Names:Name:qoxC Ordered Locus Names:SE_0757

Expression Region:1-201

Sequence Info:full length protein

View full details