Recombinant Staphylococcus epidermidis Na(+)-H(+) antiporter subunit G1(mnhG1)

CSB-CF814606SLD

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus epidermidis (strain ATCC 12228)

Uniprot NO.:Q8CPV4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIATIVTSVSIIFVVLGALISAFAATGLIRLRDVYSRAHAAGKAATLGAMFLLFGAFLYF IGTEGYVNMQLIIGIIFVFITGPLSSHLIMKAAYNIKTPYTKDTKIDEIKEDMKHTKL

Protein Names:Recommended name: Na(+)/H(+) antiporter subunit G1 Alternative name(s): Mnh complex subunit G1

Gene Names:Name:mnhG1 Ordered Locus Names:SE_0640

Expression Region:1-118

Sequence Info:full length protein