Recombinant Staphylococcus epidermidis Na(+)-H(+) antiporter subunit C1(mnhC1)

CSB-CF813259SLD

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus epidermidis (strain ATCC 12228)

Uniprot NO.:Q8CPV0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEIIMIFVSGILTSISVYLVLSKSLIRIIMGTTLLTHAANLFLITMGGLKHGTVPIFEKG TSSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVELMKGAPEDDRE

Protein Names:Recommended name: Na(+)/H(+) antiporter subunit C1 Alternative name(s): Mnh complex subunit C1

Gene Names:Name:mnhC1 Ordered Locus Names:SE_0644

Expression Region:1-115

Sequence Info:full length protein