Gene Bio Systems
Recombinant Staphylococcus aureus Protein msa(msa)
Recombinant Staphylococcus aureus Protein msa(msa)
SKU:CSB-CF653020SKU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus aureus (strain bovine RF122 / ET3-1)
Uniprot NO.:Q2YY17
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKYLILSLVANLLVFGVLSAIGLNINILAAMMMILVIPITISGILFFKTNLDKTYIFFNI LFIDFYYYIYNVHLMALPRFNSYIKAEMMELEDIDVLITSKDFGFDEILFFTLYLLLILI ILYYLKKQVKTKS
Protein Names:Recommended name: Protein msa Alternative name(s): Modulator of sarA
Gene Names:Name:msa Ordered Locus Names:SAB1257c
Expression Region:1-133
Sequence Info:full length protein
