Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus Phospholipase C(hlb)

Recombinant Staphylococcus aureus Phospholipase C(hlb)

SKU:CSB-YP357824FKZ

Regular price €880,95 EUR
Regular price Sale price €880,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: hlb

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Staphylococcus aureus (strain MRSA252)

Delivery time: 3-7 business days

Uniprot ID: P09978

AA Sequence: ESKKDDTDLKLVSHNVYMLSTVLYPNWGQYKRADLIGQSSYIKNNDVVIFNEAFDNGASDKLLSNVKKEYPYQTPVLGRSQSGWDKTEGSYSSTVAEDGGVAIVSKYPIKEKIQHVFKSGCGFDNDSNKGFVYTKIEKNGKNVHVIGTHTQSEDSRCGAGHDRKIRAEQMKEISDFVKKKNIPKDETVYIGGDLNVNKGTPEFKDMLKNLNVNDVLYAGHNSTWDPQSNSIAKYNYPNGKPEHLDYIFTDKDHKQPKQLVNEVVTEKPKPWDVYAFPYYYVYNDFSDHYPIKAYSK

Tag info: N-terminal 6xHis-tagged

Expression Region: 35-330aa

Protein length: Full Length of Mature Protein

MW: 35.7 kDa

Alternative Name(s): Beta-hemolysin Beta-toxin Sphingomyelinase plc

Relevance: Bacterial hemolysins are exotoxins that attack blood cell membranes and cause cell rupture. Beta-hemolysin is a phospholipase C with specific activity toward sphingomyelins. Has a high specificity for sphingomyelin, hydrolyzes lysophosphatidylcholine at a much lower rate, but has no activity towards phosphatidylcholine, phosphatidylethanolamine, or phosphatidylserine

Reference: "Insertional inactivation of the Staphylococcus aureus beta-toxin by bacteriophage phi 13 occurs by site- and orientation-specific integration of the phi 13 genome." Coleman D., Knights J., Russell R., Shanley D., Birkbeck T.H., Dougan G., Charles I. Mol. Microbiol. 5:933-939(1991)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details