Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus Na(+)-H(+) antiporter subunit B1

Recombinant Staphylococcus aureus Na(+)-H(+) antiporter subunit B1

SKU:CSB-CF353067SKX

Regular price €1.424,95 EUR
Regular price Sale price €1.424,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain Mu50 / ATCC 700699)

Uniprot NO.:P60676

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Protein Names:Recommended name: Na(+)/H(+) antiporter subunit B1 Alternative name(s): Mnh complex subunit B1

Gene Names:Name:mnhB1 Ordered Locus Names:SAV0951

Expression Region:1-142

Sequence Info:full length protein

View full details