Gene Bio Systems
Recombinant Staphylococcus aureus Multidrug resistance efflux pump sepA(sepA)
Recombinant Staphylococcus aureus Multidrug resistance efflux pump sepA(sepA)
SKU:CSB-CF412676SUI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus aureus (strain JH1)
Uniprot NO.:A6U3P7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GAIFLTFLGFGLYGLSRILIYFRLGDFTYNRSMYDNLLYYGSYIIFGYFIIFAVEHLMDY FRKMLPENAYFRGATFHLISYTVATTLFYFIIHLNYVYINIDFWVIMVIIGFLYVCKLQF YPESKNLNN
Protein Names:Recommended name: Multidrug resistance efflux pump sepA Alternative name(s): Antiseptic resistance protein sepA Staphylococcal efflux pump A
Gene Names:Name:sepA Ordered Locus Names:SaurJH1_2237
Expression Region:27-155
Sequence Info:full length protein
