
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P0A0L5
Gene Names: entC3
Organism: Staphylococcus aureus
AA Sequence: ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Expression Region: 28-266aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 43.6 kDa
Alternative Name(s): SEC3
Relevance: Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
Reference: Crystal structure of a T-cell receptor beta-chain complexed with a superantigen.Fields B.A., Malchiodi E.L., Li H., Ysern X., Stauffacher C.V., Schlievert P.M., Karjalainen K., Mariuzza R.A.Nature 384:188-192(1996)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Staphylococcus aureus Enterotoxin type A(entA),partial
- Regular price
- €747,95 EUR
- Sale price
- €747,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Enterotoxin type H(entH)
- Regular price
- €820,95 EUR
- Sale price
- €820,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Enterotoxin type C-2(entC2)
- Regular price
- €747,95 EUR
- Sale price
- €747,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Enterotoxin type D(entD)
- Regular price
- €747,95 EUR
- Sale price
- €747,95 EUR
- Regular price
-
- Unit price
- per
Sold out